Lineage for d1cdtb_ (1cdt B:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032122Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 3032123Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 3032124Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 3032242Protein Cardiotoxin V4II (Toxin III) [57314] (1 species)
  7. 3032243Species Naja mossambica mossambica [TaxId:196380] [57315] (1 PDB entry)
  8. 3032245Domain d1cdtb_: 1cdt B: [44416]
    complexed with po4

Details for d1cdtb_

PDB Entry: 1cdt (more details), 2.5 Å

PDB Description: cardiotoxin v4/ii from naja mossambica mossambica: the refined crystal structure
PDB Compounds: (B:) cardiotoxin vii4

SCOPe Domain Sequences for d1cdtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cdtb_ g.7.1.1 (B:) Cardiotoxin V4II (Toxin III) {Naja mossambica mossambica [TaxId: 196380]}
lkcnklipiayktcpegknlcykmmlaskkmvpvkrgcinvcpknsalvkyvccstdrcn

SCOPe Domain Coordinates for d1cdtb_:

Click to download the PDB-style file with coordinates for d1cdtb_.
(The format of our PDB-style files is described here.)

Timeline for d1cdtb_: