PDB entry 1ca7

View 1ca7 on RCSB PDB site
Description: macrophage migration inhibitory factor (mif) with hydroxphenylpyruvate
Class: cytokine
Keywords: protein hormone, cytokine, enzyme
Deposited on 1999-02-25, released 1999-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (macrophage migration inhibitory factor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d1ca7a_
• Chain 'B':
  Compound: protein (macrophage migration inhibitory factor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d1ca7b_
• Chain 'C':
  Compound: protein (macrophage migration inhibitory factor)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14174 (0-113)
  Domains in SCOPe 2.08: d1ca7c_
• Heterogens: ENO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ca7A (A:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ca7B (B:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ca7C (C:)
  pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
  lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa