Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries) |
Domain d1ca7c_: 1ca7 C: [39848] complexed with eno |
PDB Entry: 1ca7 (more details), 2.5 Å
SCOPe Domain Sequences for d1ca7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ca7c_ d.80.1.3 (C:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]} pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d1ca7c_: