PDB entry 1c9o

View 1c9o on RCSB PDB site
Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Class: transcription
Keywords: beta barrel, homodimer, transcription
Deposited on 1999-08-03, released 2000-04-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cold-shock protein
  Species: Bacillus caldolyticus [TaxId:1394]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41016 (0-65)
  Domains in SCOPe 2.08: d1c9oa_
• Chain 'B':
  Compound: cold-shock protein
  Species: Bacillus caldolyticus [TaxId:1394]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41016 (0-65)
  Domains in SCOPe 2.08: d1c9ob_
• Heterogens: NA, TRS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c9oA (A:)
  mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
  anvvkl
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c9oB (B:)
  mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
  anvvkl