PDB entry 1c9o

View 1c9o on RCSB PDB site
Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp
Class: transcription
Keywords: beta barrel, homodimer, transcription
Deposited on 1999-08-03, released 2000-04-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cold-shock protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9oa_
  • Chain 'B':
    Compound: cold-shock protein
    Species: Bacillus caldolyticus [TaxId:1394]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1c9ob_
  • Heterogens: NA, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9oA (A:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c9oB (B:)
    mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
    anvvkl