SCOPe 2.08: Domain d1c9ob_: 1c9o B:

Lineage for d1c9ob_ (1c9o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus caldolyticus [TaxId:1394] [50286] (8 PDB entries)

8. Domain d1c9ob_: 1c9o B: [25326]
   complexed with na, trs

Details for d1c9ob_

PDB Entry: 1c9o, 1.17 Å

PDB Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp

PDB Compounds: (B:) cold-shock protein

SCOPe Domain Sequences for d1c9ob_:

Sequence; same for both SEQRES and ATOM records:

>d1c9ob_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

Timeline for d1c9ob_:

• d1c9ob_ first appeared (with stable ids) in SCOP 1.55
  
• d1c9ob_ appears in SCOPe 2.07