PDB entry 1c7k

View 1c7k on RCSB PDB site
Description: crystal structure of the zinc protease
Class: hydrolase
Keywords: alpha and beta protein, METALLOPROTEINASE, HYDROLASE
Deposited on 2000-02-19, released 2001-04-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.154
AEROSPACI score: 1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: zinc endoprotease
  Species: Streptomyces caespitosus [TaxId:53502]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (0-131)
  Domains in SCOPe 2.05: d1c7ka_
• Heterogens: ZN, CA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1c7kA (A:)
  tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
  grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
  ersrvnalwang