Lineage for d1c7ka_ (1c7k A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1917422Family d.92.1.1: Zinc protease [55487] (2 proteins)
    single domain
    automatically mapped to Pfam PF02031
  6. 1917423Protein Zinc protease [55488] (1 species)
  7. 1917424Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries)
  8. 1917425Domain d1c7ka_: 1c7k A: [59078]
    complexed with ca, zn

Details for d1c7ka_

PDB Entry: 1c7k (more details), 1 Å

PDB Description: crystal structure of the zinc protease
PDB Compounds: (A:) zinc endoprotease

SCOPe Domain Sequences for d1c7ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]}
tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh
grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq
ersrvnalwang

SCOPe Domain Coordinates for d1c7ka_:

Click to download the PDB-style file with coordinates for d1c7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1c7ka_: