Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.1: Zinc protease [55487] (2 proteins) single domain automatically mapped to Pfam PF02031 |
Protein Zinc protease [55488] (1 species) |
Species Streptomyces caespitosus [TaxId:53502] [55489] (2 PDB entries) |
Domain d1c7ka_: 1c7k A: [59078] complexed with ca, zn |
PDB Entry: 1c7k (more details), 1 Å
SCOPe Domain Sequences for d1c7ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7ka_ d.92.1.1 (A:) Zinc protease {Streptomyces caespitosus [TaxId: 53502]} tvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdgh grgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypnaq ersrvnalwang
Timeline for d1c7ka_: