PDB entry 1c57

View 1c57 on RCSB PDB site
Description: direct determination of the positions of deuterium atoms of bound water in concanavalin a by neutron laue crystallography
Class: sugar binding protein
Keywords: concanavalin a, neutron laue diffraction, bound d2o molecules, sugar binding protein
Deposited on 1999-10-26, released 2000-05-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NEUT
Resolution: 2.4 Å
R-factor: 0.27
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (concanavalin a)
    Species: Canavalia ensiformis [TaxId:3823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02866 (118-236)
      • see remark 999 (150)
      • see remark 999 (154)
    Domains in SCOPe 2.04: d1c57a_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1c57A (A:)
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan