PDB entry 1c3q

View 1c3q on RCSB PDB site
Description: crystal structure of native thiazole kinase in the monoclinic form
Class: transferase
Keywords: alpha-beta, ATP binding, kinase, transferase
Deposited on 1999-07-28, released 1999-08-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.206
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hydroxyethylthiazole kinase)
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c3qa1, d1c3qa2
  • Chain 'B':
    Compound: protein (hydroxyethylthiazole kinase)
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c3qb1, d1c3qb2
  • Chain 'C':
    Compound: protein (hydroxyethylthiazole kinase)
    Species: Bacillus subtilis [TaxId:1423]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1c3qc1, d1c3qc2
  • Heterogens: CL, TZE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qA (A:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qB (B:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c3qC (C:)
    mrgshhhhhhgsmdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmaya
    keevadmakiagalvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesa
    rdiirevrlaairgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviait
    gevdviadtshvytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygva
    aqlaaqqtadkgpgsfqiellnklstvteqdvqewatiervtvs