PDB entry 1c1e

View 1c1e on RCSB PDB site
Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
Class: immune system
Keywords: catalytic antibody, diels-alder, immunoglobulin, immune system
Deposited on 1999-07-22, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.239
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: catalytic antibody 1e9 (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C1E (0-218)
    Domains in SCOPe 2.07: d1c1eh1, d1c1eh2
  • Chain 'L':
    Compound: catalytic antibody 1e9 (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1C1E (0-215)
    Domains in SCOPe 2.07: d1c1el1, d1c1el2
  • Heterogens: MLT, ENH, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1eH (H:)
    qiqlvqsgpelkkpgetvkisckasgymftnygmnwvkqapgkalklmgwinpytgestf
    addfkgrfaffletsattaylqinnlknedmatyfcargttivramdywgqgtsltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1c1eL (L:)
    elvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspkfliykvsnrf
    sgvpdrfggsgsgtdfilkisrveaedlgvyfcfqsthffptfgggtkleiksadaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr