Lineage for d1c1el2 (1c1e L:108-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2749038Species Mouse (Mus musculus) [TaxId:10090] [88567] (374 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2749161Domain d1c1el2: 1c1e L:108-211 [21250]
    Other proteins in same PDB: d1c1eh1, d1c1eh2, d1c1el1
    part of Diels-Alder catalytic Fab 1E9
    complexed with enh, mlt

Details for d1c1el2

PDB Entry: 1c1e (more details), 1.9 Å

PDB Description: crystal structure of a diels-alderase catalytic antibody 1e9 in complex with its hapten
PDB Compounds: (L:) catalytic antibody 1e9 (light chain)

SCOPe Domain Sequences for d1c1el2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1el2 b.1.1.2 (L:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
sadaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d1c1el2:

Click to download the PDB-style file with coordinates for d1c1el2.
(The format of our PDB-style files is described here.)

Timeline for d1c1el2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1el1