PDB entry 1bzl

View 1bzl on RCSB PDB site
Description: crystal structure of trypanosoma cruzi trypanothione reductase in complex with trypanothione, and the structure-based discovery of new natural product inhibitors
Class: oxidoreductase
Keywords: oxidoreductase, trypanothione reductase, fad dependent disulphide oxidoreductase
Deposited on 1998-11-02, released 1999-11-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trypanothione reductase (oxidized form)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzla1, d1bzla2, d1bzla3
  • Chain 'B':
    Compound: trypanothione reductase (oxidized form)
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bzlb1, d1bzlb2, d1bzlb3
  • Heterogens: FAD, GCG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzlA (A:)
    mskifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpk
    klmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegl
    efflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissne
    afylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltk
    qltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnag
    vmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtr
    vasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsd
    gtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkg
    ekmekp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bzlB (B:)
    mskifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpk
    klmvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegl
    efflgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissne
    afylpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltk
    qltangiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnag
    vmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtr
    vasavfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsd
    gtvlgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkg
    ekmekp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bzlB (B:)
    ifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkklm
    vtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdtegleff
    lgwgslesknvvnvresadpasavkerletehillasgswphmpnipgiehcissneafy
    lpepprrvltvgggfisvefagifnaykpkdgqvtlcyrgemilrgfdhtlreeltkqlt
    angiqiltkenpakvelnadgsksvtfesgkkmdfdlvmmaigrsprtkdlqlqnagvmi
    knggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprktdhtrvas
    avfsippigtcglieevaskryevvavylssftplmhkvsgskyktfvakiitnhsdgtv
    lgvhllgdnapeiiqgigiclklnakisdfyntigvhptsaeelcsmrtpsyyyvkgekm
    ekp