PDB entry 1bzf

View 1bzf on RCSB PDB site
Description: nmr solution structure and dynamics of the complex of lactobacillus casei dihydrofolate reductase with the new lipophilic antifolate drug trimetrexate, 22 structures
Class: oxidoreductase
Keywords: oxidoreductase, inhibitor/enzyme complex
Deposited on 1998-10-28, released 1999-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Lactobacillus casei [TaxId:1582]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bzfa_
  • Heterogens: TMQ

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzfA (A:)
    taflwaqdrdgligkdghlpwhlpddlhyfraqtvgkimvvgrrtyesfpkrplpertnv
    vlthqedyqaqgavvvhdvaavfayakqhpdqelviaggaqiftafkddvdtllvtrlag
    sfegdtkmiplnwddftkvssrtvedtnpalthtyevwqkka