PDB entry 1bzb

View 1bzb on RCSB PDB site
Description: glycosylated eel calcitonin
Deposited on 1998-10-27, released 1998-11-11
The last revision prior to the SCOP 1.63 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1bzba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bzbA (A:)
    csnlstcvlgklsqelhklqtyprtdvgagtp