PDB entry 1byv

View 1byv on RCSB PDB site
Description: glycosylated eel calcitonin
Class: hormone/growth factor
Keywords: horomone, calcium-regulator, osteoporosis, hormone-growth factor complex
Deposited on 1998-10-16, released 1998-10-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (calcitonin)
    Species: Anguilla japonica [TaxId:7937]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1byva_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byvA (A:)
    csnlstcvlgklsqelhklqtyprtdvgagtp