PDB entry 1byv

View 1byv on RCSB PDB site
Description: glycosylated eel calcitonin
Deposited on 1998-10-16, released 1998-10-28
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1byva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byvA (A:)
    csnlstcvlgklsqelhklqtyprtdvgagtp