PDB entry 1byh

View 1byh on RCSB PDB site
Description: molecular and active-site structure of a bacillus (1-3,1-4)-beta- glucanase
Deposited on 1992-12-31, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.168
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1byh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1byh_ (-)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn