PDB entry 1bw6

View 1bw6 on RCSB PDB site
Description: human centromere protein b (cenp-b) dna bindign domain rp1
Deposited on 1998-09-30, released 1998-10-07
The last revision prior to the SCOP 1.61 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1bw6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw6A (A:)
    mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailase