PDB entry 1bv2

View 1bv2 on RCSB PDB site
Description: lipid transfer protein from rice seeds, nmr, 14 structures
Class: lipid-binding protein
Keywords: lipid-binding protein, lipid transfer protein, rice, molecular modeling, nmr
Deposited on 1998-09-21, released 1999-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonspecific lipid transfer protein
  Species: Oryza sativa [TaxId:4530]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23096 (0-90)
    • see remark 999 (34)
  Domains in SCOPe 2.06: d1bv2a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bv2A (A:)
  itcgqvnsavgpcltyarggagpsaaccsgvrslkaaasttadrrtacnclknaargikg
  lnagnaasipskcgvsvpytisasidcsrvs