PDB entry 1bui

View 1bui on RCSB PDB site
Description: Structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action
Class: hydrolase/hydrolase inhibitor
Keywords: PLASMIN, STAPHYLOKINASE, SERINE PROTEINASE, FIBRINOLYSIS, COFACTOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-09-04, released 1999-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-04-05, with a file datestamp of 2017-03-31.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buia_
  • Chain 'B':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1buib_
  • Chain 'C':
    Compound: staphylokinase
    Species: Staphylococcus phage 42D.m [TaxId:10715]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15240 (Start-127)
      • conflict (25)
      • conflict (27)
      • conflict (34)
    Domains in SCOPe 2.07: d1buic_
  • Heterogens: 0GJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1buiA (A:)
    aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
    ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
    vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
    stelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
    twiegvmrnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buiA (A:)
    psfdcgkpqvepkkcpgvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahc
    leksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvip
    aclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqste
    lcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwi
    egvmrnn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1buiB (B:)
    aapsfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvlta
    ahcleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdk
    vipaclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvq
    stelcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfv
    twiegvmrnn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buiB (B:)
    apsfdcgkpqvepkkcpgvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah
    cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi
    paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst
    elcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw
    iegvmrnn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1buiC (C:)
    vlkgddasyfeptgpylmvnvtgvdskgnellsphyvefpikpgttltkekieyyvewal
    dataykefrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnli
    tkvviekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1buiC (C:)
    asyfeptgpylmvnvtgvdskgnellsphyvefpikpgttltkekieyyvewaldatayk
    efrvveldpsakievtyydknkkkeetksfpitekgfvvpdlsehiknpgfnlitkvvie
    kk