Lineage for d1buia_ (1bui A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056561Protein Plasmin(ogen), catalytic domain [50588] (1 species)
  7. 2056562Species Human (Homo sapiens) [TaxId:9606] [50589] (10 PDB entries)
  8. 2056576Domain d1buia_: 1bui A: [26370]
    Other proteins in same PDB: d1buic_
    complexed with 0gj

Details for d1buia_

PDB Entry: 1bui (more details), 2.65 Å

PDB Description: structure of the ternary microplasmin-staphylokinase-microplasmin complex: a proteinase-cofactor-substrate complex in action
PDB Compounds: (A:) Plasmin light chain B

SCOPe Domain Sequences for d1buia_:

Sequence, based on SEQRES records: (download)

>d1buia_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
psfdcgkpqvepkkcpgrvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaah
cleksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvi
paclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqst
elcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtw
iegvmrnn

Sequence, based on observed residues (ATOM records): (download)

>d1buia_ b.47.1.2 (A:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
psfdcgkpqvepkkcpgvvggcvahphswpwqvslrtrfgmhfcggtlispewvltaahc
leksprpssykvilgahqevnlephvqeievsrlfleptrkdiallklsspavitdkvip
aclpspnyvvadrtecfitgwgetqgtfgagllkeaqlpvienkvcnryeflngrvqste
lcaghlaggtdscqgdsggplvcfekdkyilqgvtswglgcarpnkpgvyvrvsrfvtwi
egvmrnn

SCOPe Domain Coordinates for d1buia_:

Click to download the PDB-style file with coordinates for d1buia_.
(The format of our PDB-style files is described here.)

Timeline for d1buia_: