PDB entry 1brb

View 1brb on RCSB PDB site
Description: crystal structures of rat anionic trypsin complexed with the protein inhibitors appi and bpti
Deposited on 1992-12-17, released 1994-07-31
The last revision prior to the SCOP 1.59 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Domains in SCOP 1.59: d1brbe_
  • Chain 'I':
    Domains in SCOP 1.59: d1brbi_

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brbE (E:)
    ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg
    neqfvnaakiikhpnfdrktlnndimliklsspvklnarvatvalpsscapagtqclisg
    wgntlssgvnepdllqcldapllpqadceasypgkitdnmvcvgfleggkgscqgdsggp
    vvcngelqgivswgygcalpdnpdvytkvcnyvdwiqdtiaan
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1brbI (I:)
    ageppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrta