PDB entry 1bor

View 1bor on RCSB PDB site
Description: transcription factor pml, a proto-oncoprotein, nmr, 1 representative structure at ph 7.5, 30 c, in the presence of zinc
Class: transcription regulation
Keywords: proto-oncogene, nuclear bodies (pods), leukemia, transcription regulation
Deposited on 1995-09-27, released 1997-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor pml
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bora_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1borA (A:)
    eeefqflrcqqcqaeakcpkllpclhtlcsgcleasgmqcpicqapwplgadtpal