PDB entry 1bl4

View 1bl4 on RCSB PDB site
Description: fkbp mutant f36v complexed with remodeled synthetic ligand
Class: isomerase
Keywords: isomerase, rotamase
Deposited on 1998-07-23, released 1998-09-02
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (fk506 binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    • Uniprot P20071 (0-106)
      • engineered (35)
    Domains in SCOPe 2.02: d1bl4a_
  • Chain 'B':
    Compound: protein (fk506 binding protein)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • engineered (35)
    • Uniprot P20071 (0-106)
      • engineered (35)
    Domains in SCOPe 2.02: d1bl4b_
  • Heterogens: AP1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bl4A (A:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkvdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bl4B (B:)
    gvqvetispgdgrtfpkrgqtcvvhytgmledgkkvdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle