PDB entry 1bku

View 1bku on RCSB PDB site
Description: effects of glycosylation on the structure and dynamics of eel calcitonin, nmr, 10 structures
Deposited on 1998-07-13, released 1999-01-13
The last revision prior to the SCOP 1.61 freeze date was dated 1999-03-18, with a file datestamp of 1999-03-23.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1bku__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bku_ (-)
    csnlstcvlgklsqelhklqtyprtdvgagtp