PDB entry 1bkl

View 1bkl on RCSB PDB site
Description: self-associated apo src sh2 domain
Class: v-src sh2 domain
Keywords: v-src sh2 domain, phosphotyrosine recognition domain, pp60 src sh2 domain
Deposited on 1997-05-02, released 1997-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pp60 v-src tyrosine kinase transforming protein
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00524 (Start-106)
      • conflict (17)
    Domains in SCOPe 2.07: d1bkla1, d1bkla2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bklA (A:)
    gsaeewyfgkitrreseslllnpenprgtflvresettkgayclsvsdfdnakglnvkhy
    kirkldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskefivtd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bklA (A:)
    eewyfgkitrreseslllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
    kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptskefivtd