Lineage for d1bkla1 (1bkl A:3-106)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. Protein c-src tyrosine kinase [55556] (4 species)
  7. Species Rous sarcoma virus [TaxId:11886] [69782] (12 PDB entries)
  8. Domain d1bkla1: 1bkl A:3-106 [40428]
    Other proteins in same PDB: d1bkla2

Details for d1bkla1

PDB Entry: 1bkl (more details), 2.1 Å

PDB Description: self-associated apo src sh2 domain
PDB Compounds: (A:) pp60 v-src tyrosine kinase transforming protein

SCOPe Domain Sequences for d1bkla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkla1 d.93.1.1 (A:3-106) c-src tyrosine kinase {Rous sarcoma virus [TaxId: 11886]}
eewyfgkitrreseslllnpenprgtflvresettkgayclsvsdfdnakglnvkhykir
kldsggfyitsrtqfsslqqlvayyskhadglchrltnvcptsk

SCOPe Domain Coordinates for d1bkla1 are not available.

Timeline for d1bkla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bkla2