PDB entry 1bkf

View 1bkf on RCSB PDB site
Description: fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506
Class: isomerase
Keywords: isomerase, rotamase
Deposited on 1995-10-18, released 1996-08-01
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: fk506 binding protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62942 (0-106)
    • engineered (41)
    • engineered (86)
  Domains in SCOPe 2.02: d1bkfa_
• Heterogens: FK5, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bkfA (A:)
  gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdknkpfkfmlgkqevirgwe
  egvaqmsvgqrakltispdyaygatgvpgiipphatlvfdvellkle