PDB entry 1bk8

View 1bk8 on RCSB PDB site
Description: determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
Deposited on 1998-07-15, released 2000-01-05
The last revision prior to the SCOP 1.63 freeze date was dated 2000-01-05, with a file datestamp of 2000-01-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1bk8__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bk8_ (-)
    lcnerpsqtwsgncgntahcdkqcqdwekashgachkrenhwkcfcyfnc