PDB entry 1bir

View 1bir on RCSB PDB site
Description: ribonuclease t1, phe 100 to ala mutant complexed with 2' gmp
Class: endoribonuclease
Keywords: hydrolase, nuclease, endoribonuclease
Deposited on 1996-01-04, released 1996-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (99)
  Domains in SCOPe 2.07: d1bira_
• Chain 'B':
  Compound: ribonuclease t1
  Species: Aspergillus oryzae [TaxId:5062]
  Gene: synthetic gene
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00651 (0-103)
    • conflict (24)
    • engineered (99)
  Domains in SCOPe 2.07: d1birb_
• Heterogens: CA, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1birA (A:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnavect
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1birB (B:)
  acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
  ilssgdvysggspgadrvvfnennqlagvithtgasgnnavect