PDB entry 1bh8

View 1bh8 on RCSB PDB site
Description: htafii18/htafii28 heterodimer crystal structure
Class: transcription regulation complex
Keywords: htafii28, histone fold, tata binding protein, transcription regulation complex
Deposited on 1998-06-16, released 1999-06-22
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.199
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tafii18
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1bh8a_
  • Chain 'B':
    Compound: tafii28
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1bh8b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh8A (A:)
    lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bh8B (B:)
    fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv
    cekwgempplqpkhmreavrrlkskgqip