PDB entry 1bh8

View 1bh8 on RCSB PDB site
Description: htafii18/htafii28 heterodimer crystal structure
Class: transcription regulation complex
Keywords: htafii28, histone fold, tata binding protein, transcription regulation complex
Deposited on 1998-06-16, released 1999-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tafii18
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15543 (0-44)
  Domains in SCOPe 2.08: d1bh8a_
• Chain 'B':
  Compound: tafii28
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15544 (0-88)
  Domains in SCOPe 2.08: d1bh8b_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bh8A (A:)
  lfskelrcmmygfgddqnpytesvdiledlviefitemthkamsi
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bh8B (B:)
  fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv
  cekwgempplqpkhmreavrrlkskgqip