![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein TAF(II)28 [47141] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47142] (2 PDB entries) |
![]() | Domain d1bh8b_: 1bh8 B: [16486] Other proteins in same PDB: d1bh8a_ |
PDB Entry: 1bh8 (more details), 3 Å
SCOPe Domain Sequences for d1bh8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bh8b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} fseeqlnryemyrrsafpkaaikrliqsitgtsvsqnvviamsgiskvfvgevveealdv cekwgempplqpkhmreavrrlkskgqip
Timeline for d1bh8b_: