PDB entry 1bf4

View 1bf4 on RCSB PDB site
Description: chromosomal DNA-binding protein sso7d/d(gcgaacgc) complex
Class: DNA-binding protein/DNA
Keywords: DNA binding protein, hyperthermophile, archaebacteria, complex (DNA-binding protein/DNA)
Deposited on 1998-05-27, released 1999-06-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.211
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (chromosomal protein sso7d)
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1bf4a_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*gp*tp*5iup*cp*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*gp*ap*ap*cp*gp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bf4A (A:)
    atvkfkykgeekevdiskikkvwrvgkmisftydegggktgrgavsekdapkellqmlek
    qkk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.