PDB entry 1bcx

View 1bcx on RCSB PDB site
Description: mutational and crystallographic analyses of the active site residues of the bacillus circulans xylanase
Class: hydrolase(xylan degradation)
Keywords: hydrolase(xylan degradation)
Deposited on 1994-04-01, released 1994-10-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.161
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase
    Species: Bacillus circulans [TaxId:1397]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09850 (0-184)
      • conflict (171)
    Domains in SCOPe 2.04: d1bcxa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bcxA (A:)
    astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
    ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
    drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmatcgyqssgss
    nvtvw