PDB entry 1bbp

View 1bbp on RCSB PDB site
Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.
Class: bilin binding
Keywords: bilin binding
Deposited on 1990-09-19, released 1991-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bilin binding protein
    Species: Pieris brassicae [TaxId:7116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbpa_
  • Chain 'B':
    Compound: bilin binding protein
    Species: Pieris brassicae [TaxId:7116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbpb_
  • Chain 'C':
    Compound: bilin binding protein
    Species: Pieris brassicae [TaxId:7116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbpc_
  • Chain 'D':
    Compound: bilin binding protein
    Species: Pieris brassicae [TaxId:7116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bbpd_
  • Heterogens: BLV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbpA (A:)
    nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
    vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
    kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbpB (B:)
    nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
    vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
    kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbpC (C:)
    nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
    vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
    kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bbpD (D:)
    nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
    vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
    kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn