Lineage for d1bbpd_ (1bbp D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804377Protein Bilin-binding protein [50837] (1 species)
  7. 2804378Species Cabbage butterfly (Pieris brassicae) [TaxId:7116] [50838] (6 PDB entries)
  8. 2804385Domain d1bbpd_: 1bbp D: [27150]
    complexed with blv

Details for d1bbpd_

PDB Entry: 1bbp (more details), 2 Å

PDB Description: molecular structure of the bilin binding protein (bbp) from pieris brassicae after refinement at 2.0 angstroms resolution.
PDB Compounds: (D:) bilin binding protein

SCOPe Domain Sequences for d1bbpd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbpd_ b.60.1.1 (D:) Bilin-binding protein {Cabbage butterfly (Pieris brassicae) [TaxId: 7116]}
nvyhdgacpevkpvdnfdwsnyhgkwwevakypnsvekygkcgwaeytpegksvkvsnyh
vihgkeyfiegtaypvgdskigkiyhkltyggvtkenvfnvlstdnknyiigyyckyded
kkghqdfvwvlsrskvltgeaktavenyligspvvdsqklvysdfseaackvn

SCOPe Domain Coordinates for d1bbpd_:

Click to download the PDB-style file with coordinates for d1bbpd_.
(The format of our PDB-style files is described here.)

Timeline for d1bbpd_: