PDB entry 1bah

View 1bah on RCSB PDB site
Description: a two disulfide derivative of charybdotoxin with disulfide 13-33 replaced by two alpha-aminobutyric acids, nmr, 30 structures
Deposited on 1996-06-06, released 1997-01-11
The last revision prior to the SCOP 1.59 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1bah__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bah_ (-)
    eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys