PDB entry 1b95

View 1b95 on RCSB PDB site
Description: analysis of a mutational hot-spot in the ecorv restriction endonuclease: a catalytic role for a main chain carbonyl group
Class: hydrolase/DNA
Keywords: endonuclease, restriction, ecorv, hydrolase/DNA complex
Deposited on 1999-02-19, released 1999-02-26
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restriction endonuclease ecorv
    Species: Escherichia coli [TaxId:562]
    Gene: ecoRVR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b95a_
  • Chain 'B':
    Compound: restriction endonuclease ecorv
    Species: Escherichia coli [TaxId:562]
    Gene: ecoRVR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1b95b_
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*ap*gp*ap*tp*ap*tp*cp*tp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b95A (A:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b95B (B:)
    slrsdlinalydenqkydvcgiisaegkiyplgsdtkvlstifelfsrpiinkiaekhgy
    iveepkqqnhypdftlykpsepnkkiaidikttytnkenekikftlggytsfirnntkni
    vypfdqyiahwiigyvytrvatrksslktyninelneipkpykgvkvflqdkwviagdla
    gsgnttnigsihahykdfvegkgifdsedefldywrnyertsqlrndkynniseyrnwiy
    rgrk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.