PDB entry 1b8y

View 1b8y on RCSB PDB site
Description: x-ray structure of human stromelysin catalytic domain complexed with non-peptide inhibitors: implications for inhibitor selectivity
Class: hydrolase
Keywords: hydrolase, matrix metalloproteinase-3, stromelysin-1
Deposited on 1999-02-03, released 1999-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (stromelysin-1)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08254 (0-166)
  Domains in SCOPe 2.07: d1b8ya_
• Heterogens: ZN, CA, SO4, IN7, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b8yA (A:)
  frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
  misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
  ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpp