PDB entry 1b8q

View 1b8q on RCSB PDB site
Description: solution structure of the extended neuronal nitric oxide synthase pdz domain complexed with an associated peptide
Deposited on 1999-02-01, released 1999-04-29
The last revision prior to the SCOP 1.61 freeze date was dated 2000-03-06, with a file datestamp of 2000-03-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1b8qa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b8qA (A:)
  gshmiepnvisvrlfkrkvgglgflvkervskppviisdlirggaaeqsgliqagdiila
  vndrplvdlsydsalevlrgiasethvvlilrgpegftthlettftgdgtpktirvtqpl
  gpptkav