PDB entry 1b8e

View 1b8e on RCSB PDB site
Description: high resolution crystal structure of the bovine beta-lactoglobulin (isoforms a and b) in orthorombic space group
Deposited on 1999-01-30, released 2001-05-02
The last revision prior to the SCOP 1.63 freeze date was dated 2001-05-02, with a file datestamp of 2001-05-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1b8ea_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b8eA (A:)
  livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
  wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
  clvrtpevddealekfdkalkalpmhirlsfn