PDB entry 1b8a

View 1b8a on RCSB PDB site
Description: aspartyl-tRNA synthetase
Class: ligase
Keywords: synthetase, tRNA ligase, ligase
Deposited on 1999-01-27, released 1999-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aspartyl-tRNA synthetase)
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: ASPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52428
      • conflict (121)
      • conflict (188)
      • conflict (195)
      • conflict (412)
    Domains in SCOPe 2.07: d1b8aa1, d1b8aa2
  • Chain 'B':
    Compound: protein (aspartyl-tRNA synthetase)
    Species: Thermococcus kodakarensis [TaxId:69014]
    Gene: ASPS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q52428 (0-437)
      • conflict (121)
      • conflict (188)
      • conflict (195)
      • conflict (412)
    Domains in SCOPe 2.07: d1b8ab1, d1b8ab2
  • Heterogens: MN, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8aA (A:)
    myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
    klipklrsedvvavegvvnftpkaklgfeilpekivvlnraetplpldptgkvkaeldtr
    lnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpkiiatateggtelfpmky
    feedaflaespqlykeimmasgldrvyeiapifraeehnttrhlneawsidsemafiede
    eevmsflerlvahainyvrehnakeldilnfeleepklpfprvsydkaleilgdlgkeip
    wgedidtegerllgkymmenenaplyflyqypseakpfyimkydnkpeicrafdleyrgv
    eissggqrehrhdilveqikekglnpesfefylkafrygmpphggfglgaerlikqmldl
    pnirevilfprdrrrltp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1b8aB (B:)
    myrthysseiteelngqkvkvagwvwevkdlggikflwirdrdgivqitapkkkvdpelf
    klipklrsedvvavegvvnftpkaklgfeilpekivvlnraetplpldptgkvkaeldtr
    lnnrfmdlrrpevmaifkirssvfkavrdffhengfieihtpkiiatateggtelfpmky
    feedaflaespqlykeimmasgldrvyeiapifraeehnttrhlneawsidsemafiede
    eevmsflerlvahainyvrehnakeldilnfeleepklpfprvsydkaleilgdlgkeip
    wgedidtegerllgkymmenenaplyflyqypseakpfyimkydnkpeicrafdleyrgv
    eissggqrehrhdilveqikekglnpesfefylkafrygmpphggfglgaerlikqmldl
    pnirevilfprdrrrltp