PDB entry 1b6t

View 1b6t on RCSB PDB site
Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli
Class: transferase
Keywords: coenzyme a biosynthesis, transferase
Deposited on 1999-01-18, released 2000-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phosphopantetheine adenylyltransferase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6ta_
  • Chain 'B':
    Compound: protein (phosphopantetheine adenylyltransferase)
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b6tb_
  • Heterogens: SO4, COD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6tA (A:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6tA (A:)
    kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
    gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
    ewsfissslvkevarhqgdvthflpenvhqalmakla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b6tB (B:)
    mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
    hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
    skewsfissslvkevarhqgdvthflpenvhqalmakla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6tB (B:)
    kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
    gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
    ewsfissslvkevarhqgdvthflpenvhqalmakla