Lineage for d1b6ta_ (1b6t A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2442887Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2442890Species Escherichia coli [TaxId:562] [52399] (10 PDB entries)
  8. 2442891Domain d1b6ta_: 1b6t A: [31600]
    complexed with cod, so4

Details for d1b6ta_

PDB Entry: 1b6t (more details), 1.8 Å

PDB Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli
PDB Compounds: (A:) protein (phosphopantetheine adenylyltransferase)

SCOPe Domain Sequences for d1b6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d1b6ta_:

Click to download the PDB-style file with coordinates for d1b6ta_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ta_: