Lineage for d1b6ta_ (1b6t A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) Protein Phosphopantetheine adenylyltransferase [52398] (7 species) 
Species Escherichia coli [TaxId:562] [52399] (10 PDB entries) 
Domain d1b6ta_: 1b6t A: [31600]
complexed with cod, so4
Details for d1b6ta_
PDB Entry: 1b6t (more details), 1.8 Å
PDB Description: phosphopantetheine adenylyltransferase in complex with 3'-dephospho-coa from escherichia coli
PDB Compounds: (A:) protein (phosphopantetheine adenylyltransferase)SCOPe Domain Sequences for d1b6ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6ta_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 562]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla
SCOPe Domain Coordinates for d1b6ta_:
Click to download the PDB-style file with coordinates for d1b6ta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b6ta_:
- d1b6ta_ first appeared (with stable ids) in SCOP 1.55
- d1b6ta_ appears in SCOPe 2.07
View in 3D
