PDB entry 1b6b

View 1b6b on RCSB PDB site
Description: melatonin biosynthesis: the structure of serotonin n-acetyltransferase at 2.5 a resolution suggests a catalytic mechanism
Class: transferase
Keywords: acetyltransferase
Deposited on 1999-01-13, released 2000-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (arylalkylamine n-acetyltransferase)
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b6ba_
  • Chain 'B':
    Compound: protein (arylalkylamine n-acetyltransferase)
    Species: Ovis aries [TaxId:9940]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1b6bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b6bA (A:)
    rrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfve
    grlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhv
    gaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6bA (A:)
    anefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfvegrlvaf
    iigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpav
    rravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1b6bB (B:)
    rrhtlpanefrcltpedaagvfeiereafisvsgncplnldevqhfltlcpelslgwfve
    grlvafiigslwdeerltqeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhv
    gaqpavrravlmcedalvpfyqrfgfhpagpcaivvgsltftemhcslrghaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b6bB (B:)
    nefrcltpedaagvfeiereafdevqhfltlcpelslgwfvegrlvafiigslwdeerlt
    qeslalhrprghsahlhalavhrsfrqqgkgsvllwrylhhvgaqpavrravlmcedalv
    pfyqrfgfhpagpcaivvgsltftemhcslrghaal