PDB entry 1b4o

View 1b4o on RCSB PDB site
Description: nmr study of sso7d mutant (f31a) minimized average structure
Class: DNA-binding protein
Keywords: RNAse and DNA-binding protein, thermostable ribonuclease, 3d-structure, nmr, sulfolobus solfataricus
Deposited on 1998-12-24, released 2000-01-05
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endoribonuclease p2
  Species: Sulfolobus solfataricus [TaxId:2287]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61991 (0-61)
    • conflict (30)
  Domains in SCOPe 2.04: d1b4oa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1b4oA (A:)
  atvkfkykgeekqvdiskikkvwrvgkmisatydegggktgrgavsekdapkellqmlek
  qk