PDB entry 1b3i

View 1b3i on RCSB PDB site
Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
Class: electron transport
Keywords: electron transport, type I copper protein, photosynthesis
Deposited on 1998-12-11, released 1999-04-27
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (plastocyanin)
    Species: Prochlorothrix hollandica [TaxId:1223]
    Gene: PETE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50057 (0-96)
      • see remark 999 (1)
      • see remark 999 (60)
    Domains in SCOPe 2.02: d1b3ia_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1b3iA (A:)
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve