PDB entry 1b22

View 1b22 on RCSB PDB site
Description: rad51 (n-terminal domain)
Class: DNA binding protein
Keywords: DNA BINDING, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 1998-12-04, released 1999-12-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein rad51
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1b22a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1b22A (A:)
mamqmqleanadtsveeesfgpqpisrleqcginandvkkleeagfhtveavayapkkel
inikgiseakadkilaeaaklvpmgfttatefhqrrseiiqittgskeldkllq

    Sequence, based on observed residues (ATOM records): (download) 
    >1b22A (A:)
eeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgiseakadkil
aeaaklvpmg