Lineage for d1b22a_ (1b22 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715792Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715793Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein)
  6. 2715794Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species)
  7. 2715803Species Human (Homo sapiens) [TaxId:9606] [47797] (1 PDB entry)
  8. 2715804Domain d1b22a_: 1b22 A: [17969]

Details for d1b22a_

PDB Entry: 1b22 (more details)

PDB Description: rad51 (n-terminal domain)
PDB Compounds: (A:) DNA repair protein rad51

SCOPe Domain Sequences for d1b22a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgiseakadkil
aeaaklvpmg

SCOPe Domain Coordinates for d1b22a_:

Click to download the PDB-style file with coordinates for d1b22a_.
(The format of our PDB-style files is described here.)

Timeline for d1b22a_: