| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.4: Rad51 N-terminal domain-like [47794] (4 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.4.1: DNA repair protein Rad51, N-terminal domain [47795] (1 protein) |
| Protein DNA repair protein Rad51, N-terminal domain [47796] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47797] (1 PDB entry) |
| Domain d1b22a_: 1b22 A: [17969] |
PDB Entry: 1b22 (more details)
SCOPe Domain Sequences for d1b22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b22a_ a.60.4.1 (A:) DNA repair protein Rad51, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
eeesfgpqpisrleqcginandvkkleeagfhtveavayapkkelinikgiseakadkil
aeaaklvpmg
Timeline for d1b22a_: